DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:278 Identity:92/278 - (33%)
Similarity:135/278 - (48%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYKLWWKLLLLQASGCLSL-ESRPDP-----RIVGGFPADIANIPYIVSIQL---YGIHHCGGSI 57
            |.||   ||||..|...|| .:.|.|     .||||..|..:..|:.||::.   :.:|.||||:
  Rat     1 MLKL---LLLLALSPLASLVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSL 62

  Fly    58 INNHTILTAGHC--LNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRL 120
            |:...:|||.||  |:.....|.:|::.....|..| :|.:|....||.::.......||.::.|
  Rat    63 IHPQWVLTAAHCVGLHIKSPELFRVQLREQYLYYAD-QLLTVNRTVVHPHYYTVEDGADIALLEL 126

  Fly   121 TKNLTLSRKV--KAIPINPERVAEGTYATIAGWGFKSMNGP--PSDSLRYARVPIVNQTACRNLL 181
            ...:.:|..:  .::|...|....||...:.|||....:.|  |...|:..:||||..:.|....
  Rat   127 ENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKY 191

  Fly   182 G---------KTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPG 233
            .         ..|.|.|||||..:  :|:||.||||||..:.:    ..|:||||.|||.|::||
  Rat   192 HTGLYTGDDVPIVQDGMLCAGNTR--SDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPG 254

  Fly   234 VYSR----LDALHPWLDQ 247
            :|:|    ||.:|.::.|
  Rat   255 IYTRVTYYLDWIHRYVPQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 79/242 (33%)
Tryp_SPc 28..248 CDD:238113 80/246 (33%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 78/240 (33%)
Tryp_SPc 30..266 CDD:214473 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.