DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss38

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:252 Identity:76/252 - (30%)
Similarity:118/252 - (46%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |.|..|.|..:|..    :::||........|:.|||...|.|.|||||:|.:.:|||.||. ..
  Rat    99 LFLSSACGQPALHG----KLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCF-AR 158

  Fly    74 PHRL----LKVKVGGTSRYRKDGELFSVADLQVH---ENFNPKTMDYDIGIIRLTKNLTLSRKVK 131
            ..||    :.|.:.......|..:.|.:..:.:|   |.|:|  :..|:.:::....:..|..|.
  Rat   159 EKRLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHP--VGGDVALVQSKSAIVFSDYVL 221

  Fly   132 AI--PINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKT--VTDRMLCA 192
            .|  |.:...:::.:..| .|||..|..|.....|..|::|::.:..|:.|.|.|  :...||||
  Rat   222 PICLPSSNLNLSDLSCWT-TGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCA 285

  Fly   193 GYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            |.:|...:.|:.|||.||..:..    .:||||||.|||....|||::.:.....|:
  Rat   286 GDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/231 (30%)
Tryp_SPc 28..248 CDD:238113 71/233 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 71/231 (31%)
Tryp_SPc 116..342 CDD:214473 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.