DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss34

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:276 Identity:95/276 - (34%)
Similarity:134/276 - (48%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWWKLLLLQASGCLSLESRPDP-----RIVGGFPADIANIPYIVSIQLYGI------HHCGGSII 58
            ||:..|.|...|. ::...||.     .||||.|...:..|:.||::.|.:      |.||||:|
  Rat     6 LWFLFLTLPCLGS-TMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLI 69

  Fly    59 NNHTILTAGHC--LNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTM---DYDIGII 118
            :...:|||.||  |..:.....:|:||....|..| :|..||.:..|..|:.|..   ..||.::
  Rat    70 HPQWVLTAAHCVELKEMEASCFRVQVGQLRLYEND-QLMKVAKIIRHPKFSEKLSAPGGADIALL 133

  Fly   119 RLTKNLTLSRKVK--AIPINPERVAEGTYATIAGWGFKSMNG----PPSDSLRYARVPIVNQTAC 177
            :|...:.||.:|.  ::|...:|::......:||||.  :.|    ||...||...||||..:.|
  Rat   134 KLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGV--IEGHRPLPPPCHLREVAVPIVGNSDC 196

  Fly   178 R---------NLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQL----VGIVSWGVGCALA 229
            .         :...|.:.|.|||||  ..|.|:||.||||||..|...    ||:||||:||.|.
  Rat   197 EQKYRTYSSLDRTTKIIKDDMLCAG--MEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLP 259

  Fly   230 DKPGVYSRLDALHPWL 245
            |.||||:|:.:...|:
  Rat   260 DFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 87/246 (35%)
Tryp_SPc 28..248 CDD:238113 88/248 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 88/248 (35%)
Tryp_SPc 33..275 CDD:214473 87/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.