DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and LOC286960

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:235 Identity:74/235 - (31%)
Similarity:125/235 - (53%) Gaps:7/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKV 82
            ::|....|.:||||:......:||.||:.....|.||||:|::..:|:|.||..    |.|:|::
  Rat    14 VALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYK----RKLQVRL 74

  Fly    83 GGTS-RYRKDGELFSVADLQV-HENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTY 145
            |..: ...:.||.|..|:..: |..:|..|:|.||.:|:|.....|:.:|..:.:.....:....
  Rat    75 GEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQ 139

  Fly   146 ATIAGWG-FKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGP 209
            ..::||| ..|:.|.....|:....|:::.::|:......:|..|.|.|:|:||.|:|..|||||
  Rat   140 CLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGP 204

  Fly   210 LSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            :....::.||||||..||:..|||||:::.....|:.:.:
  Rat   205 VVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 71/219 (32%)
Tryp_SPc 28..248 CDD:238113 72/222 (32%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 71/220 (32%)
Tryp_SPc 24..243 CDD:238113 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.