DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss3b

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:247 Identity:85/247 - (34%)
Similarity:134/247 - (54%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |..|.|:..|.|:. .|.:||||:.....::||.||:.. |.|.||||:||:..:::|.||... 
  Rat     7 LAFLGAAVALPLDD-DDDKIVGGYTCQKNSLPYQVSLNA-GYHFCGGSLINSQWVVSAAHCYKS- 68

  Fly    74 PHRLLKVKVGGTSRYRKD----GELF-SVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAI 133
               .::|::|   .:..|    ||.| ..|.:..|.::|..|.|.||.:|:|....||:.:|..:
  Rat    69 ---RIQVRLG---EHNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVSTV 127

  Fly   134 PINPERVAEGTYATIAGWGFKSMNGPPSDS-LRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKG 197
            .:.....:.||...::|||....:|....| |:....|:::.::|::.....:|..|.|.|:|:|
  Rat   128 SLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKITSNMFCLGFLEG 192

  Fly   198 GTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            |.|:||.|||||:....||.|:||||.|||...|||||:::.....|:.|.:
  Rat   193 GKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/222 (35%)
Tryp_SPc 28..248 CDD:238113 78/225 (35%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 77/223 (35%)
Tryp_SPc 25..243 CDD:238113 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.