DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:257 Identity:84/257 - (32%)
Similarity:126/257 - (49%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGCLSLE-SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLL 78
            |||...: |....|||||..|.....|:..|::|:.:|.||||:::...:|||.||.:|..:   
Mouse    73 SGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVN--- 134

  Fly    79 KVKVGGTSRYRKD-GELFSVADLQVHENFNPKTMDY-----------DIGIIRLTKNLTLSRKVK 131
                  :|.|:.. |||  ...|..|.:...:.:.|           ||.:::|:..:.||.:|:
Mouse   135 ------SSDYQVHLGEL--TVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQ 191

  Fly   132 AIPINPERVAE---GTYATIAGWGFKSMNGP--PSDSLRYARVPIVNQTACRNLL----GKTVTD 187
            .:.: ||..|:   |....:.|||:.....|  |..:|:.|:|.:|:...|....    |..:..
Mouse   192 PVCL-PEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQP 255

  Fly   188 RMLCAGYLKGGTDACQMDSGGPLSVRE----QLVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            .||||   :|..||||.||||||..:.    |..|:||||.||...|:||||:|:.|...|:
Mouse   256 DMLCA---RGPGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 79/241 (33%)
Tryp_SPc 28..248 CDD:238113 79/243 (33%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.