DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss38

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:234 Identity:67/234 - (28%)
Similarity:115/234 - (49%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLN-GVPHRLLKVKVGGTS--RY 88
            :::||..|.....|:.||:...|.|.|||||::.:.:|:|.||.: |.......:.||.|:  :.
Mouse    55 KLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKA 119

  Fly    89 RKDGELFSVADLQVHENF---NPKTMDYDIGIIRLTKNLTLSRKVKAIPINPE---RVAEGTYAT 147
            .:..:.|.:..:.:|..|   :|  :..|:.:::|...:..|..|..|.:.|.   .:....:.|
Mouse   120 NRHTQWFEIYQVIIHPTFQMYHP--IGGDVALVQLKSAIVFSDFVLPICLPPSDLYLINLSCWTT 182

  Fly   148 IAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKT--VTDRMLCAGYLKGGTDACQMDSGGPL 210
              |||..|..|...:.|..|::|::.:..|:.|.|.:  :...||||..:|...:.|:.|||.||
Mouse   183 --GWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPL 245

  Fly   211 SVREQ----LVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            ..::.    .:||||||.|||....|||::.:.....|:
Mouse   246 VCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 66/231 (29%)
Tryp_SPc 28..248 CDD:238113 67/233 (29%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 67/231 (29%)
Tryp_SPc 58..284 CDD:214473 66/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.