DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tmprss15

DIOPT Version :10

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_032967.1 Gene:Tmprss15 / 19146 MGIID:1197523 Length:1069 Species:Mus musculus


Alignment Length:300 Identity:84/300 - (28%)
Similarity:131/300 - (43%) Gaps:95/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQAS----GCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHH---------CGGSIINN 60
            |:|||.:    |...:..:..|:||||..|.....|::|:     ::|         ||.|::::
Mouse   807 LILLQCNHKSCGEKKVTQKVSPKIVGGSDAQAGAWPWVVA-----LYHRDRSTDRLLCGASLVSS 866

  Fly    61 HTILTAGHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLT 125
            ..:::|.||:                 ||:              |.:|......:| :.:..|||
Mouse   867 DWLVSAAHCV-----------------YRR--------------NLDPTRWTAVLG-LHMQSNLT 899

  Fly   126 ----LSRKVKAIPINP-----ERVAE------------------------------GTYATIAGW 151
                :.|.|..|.|||     .:|.:                              |...:||||
Mouse   900 SPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGW 964

  Fly   152 GFKSMN-GPPSDSLRYARVPIVNQTACRNLLGK-TVTDRMLCAGYLKGGTDACQMDSGGPLSVRE 214
            |:..:| |...|.|:.|.||:::...|:..|.: .:|:.|:||||.:||.|:||.||||||..:|
Mouse   965 GYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQE 1029

  Fly   215 Q----LVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLN 250
            .    |||:.|:||.|||.:.||||.|:.....|:...|:
Mouse  1030 NNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 76/270 (28%)
Tmprss15NP_032967.1 SEA 53..154 CDD:214554
LDLa 228..261 CDD:197566
CUB 270..376 CDD:412131
MAM 392..548 CDD:459878
CUB 569..676 CDD:395345
LDLa 688..722 CDD:238060
SR 723..816 CDD:214555 4/8 (50%)
Tryp_SPc 830..1066 CDD:238113 77/272 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.