DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and LOC1280074

DIOPT Version :10

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_061518925.1 Gene:LOC1280074 / 1280074 VectorBaseID:AGAMI1_006871 Length:275 Species:Anopheles gambiae


Alignment Length:61 Identity:17/61 - (27%)
Similarity:26/61 - (42%) Gaps:10/61 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 AASVDLGYQTKTPSAAGSDTAPAVDIPAHI--LA-------QFEQETLHSDYKRDSFRARH 897
            :|::..|..:..|| ||...|....:|||.  ||       |:|.|...::.......||:
Mosquito    23 SANLATGRASLRPS-AGKRAAVVGRLPAHYYQLASAVRSPKQYENEFTCNENTMSVINARY 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473
LOC1280074XP_061518925.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.