DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and PRSS21

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:283 Identity:81/283 - (28%)
Similarity:136/283 - (48%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQASGCLSLESRP-------------DPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNH 61
            |||..:|....||:.             ..|||||..|::...|:..|::|:..|.||.|::::.
Human    11 LLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHR 75

  Fly    62 TILTAGHCLNGVPHRLLKVKVGGTSRYRKDGELFSVA---DLQVHEN--------FNPKTM---D 112
            ..|||.||..  .:..|....|...::   |:|.|:.   .||.:..        .:|:.:   .
Human    76 WALTAAHCFE--TYSDLSDPSGWMVQF---GQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSP 135

  Fly   113 YDIGIIRLTKNLTLSRKVKAIPINPE--RVAEGTYATIAGWGF-KSMNGPPS-DSLRYARVPIVN 173
            |||.:::|:..:|.::.::.|.:...  .....|...:.|||: |.....|| .:|:..:|.|:|
Human   136 YDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIIN 200

  Fly   174 QTACRNL-----LGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALA 229
            .:.|.:|     ..|.:...|:|||..:||.|||..||||||:..:.    .:|:|||||||...
Human   201 NSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRP 265

  Fly   230 DKPGVYSRLDALHPWLDQVLNKS 252
            ::||||:.:.....|:.:::.:|
Human   266 NRPGVYTNISHHFEWIQKLMAQS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 73/243 (30%)
Tryp_SPc 28..248 CDD:238113 73/246 (30%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.