DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Try5

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:83/246 - (33%)
Similarity:132/246 - (53%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |.|......::.....|.:||||:.....::||.||:. .|.|.||||:||:..:::|.||... 
  Rat     5 LFLAHVGAAVAFPIDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKS- 67

  Fly    74 PHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPIN 136
               .::|::|..:....:|  :..:.|.:..|.|||.:.::.||.:|:|:..:||:.:|..:.:.
  Rat    68 ---RIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVATVALP 129

  Fly   137 PERVAEGTYATIAGWG---FKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGG 198
            ......||...|:|||   ...:|.|  |.|:....|::.|..|.......:|:.|:|.|:|:||
  Rat   130 SSCAPAGTQCLISGWGNTLSLGVNNP--DLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEGG 192

  Fly   199 TDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            .|:||.|||||:....||.||||||.||||.|.||||:::.....|:...:
  Rat   193 KDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 79/221 (36%)
Tryp_SPc 28..248 CDD:238113 80/224 (36%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 79/222 (36%)
Tryp_SPc 24..242 CDD:238113 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.