DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and LOC102554637

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:83/246 - (33%)
Similarity:135/246 - (54%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |:|:.....::.....|.:||||:.....::||.||:. .|.|:||||:||:..:::|.||... 
  Rat     5 LVLVLVGAAVAFPVDDDDKIVGGYTCQEHSVPYQVSLN-SGYHYCGGSLINDQWVVSAAHCYKS- 67

  Fly    74 PHRLLKVKVG--GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPIN 136
               .::|::|  ..:....|.:..:.|.:..|.||:.||::.||.:|:|:..:.|:.:|..:.:.
  Rat    68 ---RIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALP 129

  Fly   137 PERVAEGTYATIAGWGFK---SMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGG 198
            ......||...|:|||..   .:|.|  |.|:....|::.|..|.......:|:.|:|||:|:||
  Rat   130 SSCAPAGTQCLISGWGNTLSFGVNDP--DLLQCLDAPLLPQADCEASYPGKITNNMVCAGFLEGG 192

  Fly   199 TDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            .|:||.|||||:....:|.||||||.||||.|.||||:::.....|:...:
  Rat   193 KDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 79/221 (36%)
Tryp_SPc 28..248 CDD:238113 80/224 (36%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.