DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and prss56

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:252 Identity:100/252 - (39%)
Similarity:139/252 - (55%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRL 77
            |....:|..:.|..|||||......:.|::|:|:..|...|||.::::..||||.||..|..:.:
 Frog    60 QKFSSISNNTGPKGRIVGGSITSPGSWPWLVNIRFNGELMCGGVLLDDMWILTAAHCFTGSVNEV 124

  Fly    78 LKVKVGGTSRYRKDGE---LFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK--AIPINP 137
            |...|.|.....|:.:   .|.|..:..|..||.||.|.|:.::.||.::|.|:..:  .:|..|
 Frog   125 LWTVVVGQYDLTKNAQGEKTFQVNRIVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPVP 189

  Fly   138 ERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKT-VTDRMLCAGYLKGGTDA 201
            .....||...|||||....:||.||.:..||||:::|.|||:.|||. :|..|.|||||.||.|:
 Frog   190 RDPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACRSTLGKNMLTSTMFCAGYLNGGIDS 254

  Fly   202 CQMDSGGPLSVREQ------LVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
            ||.||||||:.::.      |.||.|||.||....|||||:|:.|...|:...:|||
 Frog   255 CQGDSGGPLTCQDPISKQYVLYGITSWGDGCGERGKPGVYTRVTAFTDWISHQMNKS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 93/228 (41%)
Tryp_SPc 28..248 CDD:238113 93/231 (40%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 93/229 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.