DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk9

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:264 Identity:84/264 - (31%)
Similarity:125/264 - (47%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLWWKLLL--LQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66
            ||...|:|  |.|..|     ..|.|.||.......:.|:...:.......||.::||:..:|||
Mouse     2 KLGLTLVLFSLLAGHC-----GADTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTA 61

  Fly    67 GHCLNGVPHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNP--KTMDY--DIGIIRLTKNLT 125
            .||..  |:  |.|::|....:|.:|  :|..|.|...|..|||  ...|:  ||.:|||.:.:.
Mouse    62 AHCRK--PY--LWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVR 122

  Fly   126 LSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRY------ARVPIVNQTACRNLLGKT 184
            |:..|:.:.:...|...||...|:|||..|     |..|:|      |.:.|::...||......
Mouse   123 LTPAVQPLNLTESRPPVGTQCLISGWGSVS-----SSKLQYPMTLQCANISILDNKLCRWAYPGH 182

  Fly   185 VTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWG-VGCALADKPGVYSRLDALHPWLDQV 248
            ::::|||||..:||..:||.||||||.....|.||||.| ..|:...:|.||:.:.....|::..
Mouse   183 ISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIEST 247

  Fly   249 LNKS 252
            :.|:
Mouse   248 MEKN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 74/229 (32%)
Tryp_SPc 28..248 CDD:238113 74/232 (32%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.