DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and prss59.2

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:246 Identity:84/246 - (34%)
Similarity:138/246 - (56%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |:||.|:..|.     |.:||||:.....:.|:..|:. .|.|.||||:::.:.:::|.||... 
Zfish     7 LVLLGAAFALD-----DDKIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYWVVSAAHCYKS- 64

  Fly    74 PHRLLKVKVGGTSRYRKDG-ELFSVADLQV-HENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPIN 136
               .|:|::|..:....:| |.|..::..: :.|::..|:|.||.:|:|:|..||::.|:.:.:.
Zfish    65 ---RLEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALP 126

  Fly   137 PERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDA 201
            ....|:||...::|||....:...|:.|:...:||::...|:|.....:||.|.|||||:||.|:
Zfish   127 NGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSYPGMITDTMFCAGYLEGGKDS 191

  Fly   202 CQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
            ||.|||||:....:|.||||||.|||..|.||||.::.....|:...:..:
Zfish   192 CQGDSGGPVVCNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADTMRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/218 (35%)
Tryp_SPc 28..248 CDD:238113 78/221 (35%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 77/219 (35%)
Tryp_SPc 21..238 CDD:238113 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.