DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tpsab1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:273 Identity:91/273 - (33%)
Similarity:135/273 - (49%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLLQASGCLSL-ESRPDPR-----IVGGFPADIANIPYIVSIQ---LYGIHHCGGSIINNHTI 63
            |||||......|| .:.|.|.     ||||..|.....|:.||::   .|.:|.||||:|:...:
Mouse     3 KLLLLTLPLLSSLVHAAPGPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWV 67

  Fly    64 LTAGHCLN---GVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLT 125
            |||.||:.   ..|:: ::|::.....|..| .|.:|:.:..|.:|.......||.:::||..:.
Mouse    68 LTAAHCVGPDVADPNK-VRVQLRKQYLYYHD-HLMTVSQIITHPDFYIVQDGADIALLKLTNPVN 130

  Fly   126 LSRKVKAIPINP--ERVAEGTYATIAGWG--FKSMNGPPSDSLRYARVPIVNQTAC-----RNLL 181
            :|..|..:|:.|  |....||...:.|||  ...:|.||...|:..:|||:....|     :.|:
Mouse   131 ISDYVHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLI 195

  Fly   182 G----KTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRL 238
            .    ..|.|.|||||  ..|.|:||.||||||..:.:    ..|:||||.|||..::||:|:|:
Mouse   196 TGDNVHIVRDDMLCAG--NEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRV 258

  Fly   239 DALHPWLDQVLNK 251
            .....|:...:.|
Mouse   259 TYYLDWIHHYVPK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 80/244 (33%)
Tryp_SPc 28..248 CDD:238113 81/242 (33%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 81/240 (34%)
Tryp_SPc 29..265 CDD:214473 80/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.