DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Gm10334

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:244 Identity:84/244 - (34%)
Similarity:132/244 - (54%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |:|......::.....|.:||||:.....::||.||:. .|.|.||||:||:..:::|.||..  
Mouse     5 LILALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYK-- 66

  Fly    74 PHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPIN 136
              ..::|::|..:....:|  :..:.|.:..|.|||.||::.||.:|:|:..:||:.:|..:.:.
Mouse    67 --TRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALP 129

  Fly   137 PERVAEGTYATIAGWG-FKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTD 200
            ......||...|:||| ..|......|.|:....|::.|..|.......:|..|:|||:|:||.|
Mouse   130 SSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNMVCAGFLEGGKD 194

  Fly   201 ACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            :||.|||||:....:|.||||||.||||.|.||||:::.....|:...:
Mouse   195 SCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 80/219 (37%)
Tryp_SPc 28..248 CDD:238113 81/222 (36%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.