DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and gzm3.3

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:254 Identity:78/254 - (30%)
Similarity:117/254 - (46%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLN-- 71
            ||||    .:||....|..|:||..|...:.||:.|||:...|.|||.:|.:..:|||.||||  
Zfish     7 LLLL----AISLAGGMDSGIIGGKVAKAHSRPYMASIQINKHHTCGGMLIRDDYVLTAAHCLNRG 67

  Fly    72 ---GVPHRLLKVKVG--GTSRYRKDGELFSVADLQVHENF---NPKTMDYDIGIIRLTKNLTLSR 128
               |..|  |:|.:|  ..|::.::.:...|.....|..|   ..|...|||.:::|.....:|:
Zfish    68 VYSGRGH--LEVVLGAHNISKHEQNQQRIQVKKYIRHPMFQRNKEKDYSYDIMLLKLKNKAKISK 130

  Fly   129 KVKAI--PINPERVAEGTYATIAGWGF-KSMNGPPSDSLRYARVPIVNQTACRNLLGKTV-TDRM 189
            .||.|  |....::......::||||. |......||.|....:.:.....|:.:..:.. |:||
Zfish   131 FVKVISLPKKNGKIPANVKCSVAGWGLTKPKAELASDVLEEVTLKLQFDFECKTMWQQHFNTERM 195

  Fly   190 LCAGYLKGGTDA-CQMDSGGPLSVREQLVGIVSWGV--GCALADKPGVYSRLDALHPWL 245
            :|:  :..|..| ||.||||||....:...|||:..  .|.....|.|:.::....||:
Zfish   196 ICS--VSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGNCINKQYPQVFLKISYFLPWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 69/233 (30%)
Tryp_SPc 28..248 CDD:238113 71/235 (30%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 71/235 (30%)
Tryp_SPc 22..252 CDD:214473 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.