DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and AT3G55580

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_191117.1 Gene:AT3G55580 / 824723 AraportID:AT3G55580 Length:488 Species:Arabidopsis thaliana


Alignment Length:370 Identity:89/370 - (24%)
Similarity:139/370 - (37%) Gaps:126/370 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 AGCAYCACVVDG-TAYFWG---------------------------------------SSGIPSY 1146
            ||.|:|..|.:. ..|.||                                       |.|..|.
plant   124 AGWAHCVAVTENQQVYTWGWRECIPTGRVFGQVDGDSCERNISFSTEQVSSSSQGKKSSGGTSSQ 188

  Fly  1147 YSAQKSTEP-------PEPAHAVKSLDLLSQL-NLQVHAIKC---------------GRQHTLIL 1188
            ...:...||       |....|..|    ||. |:.:.|:.|               |.:|||.|
plant   189 VEGRGGGEPTKKRRISPSKQAAENS----SQSDNIDLSALPCLVSLAPGVRIVSVAAGGRHTLAL 249

  Fly  1189 TNNG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALD----------GMN--------------IT 1228
            ::.| ::..|.....|||:|..:::...|..:..::          |:|              :.
plant   250 SDIGQVWGWGYGGEGQLGLGSRVRLVSSPHPIPCIEPSSYGKATSSGVNMSSVVQCGRVLGSYVK 314

  Fly  1229 MLEAGQYHNAAVAD-GKLYMWGWGIYGQLGQGSCENIATPQLVSFFKFKKILQISLGHAHTLVLC 1292
            .:..|..|:|.:.| |.|..:|||:|||.||||.::..:|..||.....:|.:::.|..||  .|
plant   315 KIACGGRHSAVITDTGALLTFGWGLYGQCGQGSTDDELSPTCVSSLLGIRIEEVAAGLWHT--TC 377

  Fly  1293 GAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTKTNLPVRLEVGD----------CSLRLI 1347
            .:.:         .:::.||.|.||||||| .|..:|   ||..||..:          |..|  
plant   378 ASSD---------GDVYAFGGNQFGQLGTG-CDQAET---LPKLLEAPNLENVNVKTISCGAR-- 427

  Fly  1348 HTKFFTNLAVDEQDRLFTWGSSPQA-LRLANQIKRRANAKQKMEE 1391
            ||...|     ::.|:|.||.:... |.:.:.|.|.|.|:.::::
plant   428 HTAVIT-----DEGRVFCWGWNKYGQLGIGDVIDRNAPAEVRIKD 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 75/287 (26%)
RCC1_2 1175..1200 CDD:290274 9/40 (23%)
RCC1 1193..1240 CDD:278826 11/70 (16%)
RCC1 1242..1291 CDD:278826 20/49 (41%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
AT3G55580NP_191117.1 ATS1 83..463 CDD:227511 89/364 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22870
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.