DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and AT3G53830

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_001327553.1 Gene:AT3G53830 / 824550 AraportID:AT3G53830 Length:500 Species:Arabidopsis thaliana


Alignment Length:366 Identity:90/366 - (24%)
Similarity:144/366 - (39%) Gaps:89/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1044 PALRPIVSHNSDCAMSNDNNPQLFEFCKSLI-------ETYLAVLIHMESQRVKYDSIVNALSNF 1101
            |:..|:....|..:...|....:|. |..:|       .|:..|::...||.      .||.|..
plant   136 PSKDPVGKQQSGSSEQGDIGWDIFG-CSVVIFLLLMDMVTFSIVIVSPASQG------SNAASGT 193

  Fly  1102 RINYEDNQFAIESSRFKPISAGCAYCACVVDGTAYFWGSSGIPSYYSAQKSTEPPEPAHAVKSLD 1166
            .:..|:.:...||.:.:.:|...........|..:|   :..||..|.                 
plant   194 TLQNENQKVGEESVKRRRVSTAKDETEGHTSGGDFF---ATTPSLVSV----------------- 238

  Fly  1167 LLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALD------- 1223
               .|.:::.::..|.:|||.|::.| ::..|.....|||:|..::|...|.|:..|:       
plant   239 ---GLGVRITSVATGGRHTLALSDLGQIWGWGYGGEGQLGLGSRIKMVSSPHLIPCLESIGSGKE 300

  Fly  1224 --------GMNITMLEA----GQY---------HNAAVAD-GKLYMWGWGIYGQLGQGSCENIAT 1266
                    |...|..:|    |||         |:||:.| |.|..:|||:|||.|.|:..:...
plant   301 RSFILHQGGTTTTSAQASREPGQYIKAISCGGRHSAAITDAGGLITFGWGLYGQCGHGNTNDQLR 365

  Fly  1267 PQLVSFFKFKKILQISLGHAHTLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTKT 1331
            |..||..|..::..::.|..||:.:..           ..:::.||.|.||||||| :||.:.  
plant   366 PMAVSEVKSVRMESVAAGLWHTICISS-----------DGKVYAFGGNQFGQLGTG-TDHAEI-- 416

  Fly  1332 NLPVRLEVGDCSLRLIHTKFFT-----NLAVDEQDRLFTWG 1367
             || ||..|. :|...|.|..:     :..:.|..:|..||
plant   417 -LP-RLLDGQ-NLEGKHAKAVSCGARHSAVLAEDGQLLCWG 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 67/245 (27%)
RCC1_2 1175..1200 CDD:290274 7/25 (28%)
RCC1 1193..1240 CDD:278826 17/74 (23%)
RCC1 1242..1291 CDD:278826 18/49 (37%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
AT3G53830NP_001327553.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22870
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.