DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and Rcc1

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_006239135.1 Gene:Rcc1 / 682908 RGDID:1592835 Length:434 Species:Rattus norvegicus


Alignment Length:339 Identity:82/339 - (24%)
Similarity:128/339 - (37%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1111 AIESSRFKP-----------ISAGCAYCACVV-DGTAYFWGS----SGIPSYYSAQKSTEPPEPA 1159
            ::|.|...|           :|||.::.|.:. ||..:.|||    :|:.......|.:..|   
  Rat   117 SVEGSEMVPGKVELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVP--- 178

  Fly  1160 HAVKSLDLLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLG------IGRHMQMALQPM 1217
                   :..||:.||..:..|..|.::||.:| ||:||.....|||      ..|..:..|:.:
  Rat   179 -------VQVQLDTQVVKVASGNDHLVMLTTDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERL 236

  Fly  1218 LVTALDGMNITMLEA--------------GQYHNAAVA-DGKLYMWGWGIYGQL---GQGSCENI 1264
            ||.     ...:|::              |.|...|:: :|.:|.:|...|.||   |.|||   
  Rat   237 LVP-----RCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSC--- 293

  Fly  1265 ATPQLVSFFK--FKKILQISLGHAHTLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHG 1327
            ..||.::.||  .|..:..|.|..||:.:    :|..:|       :..|...:|:||.|.....
  Rat   294 FIPQNLTSFKNSTKSWVGFSGGQHHTVCM----DSEGKA-------YSLGRAEYGRLGLGEGAEE 347

  Fly  1328 DTKTNLPVRLEVGD---CSLRLIHTKFFTNLAVDEQDRLFTWGSSPQALRLANQIKRRANAKQKM 1389
            .:...|..||.|..   |...:       ..||.:..|:|.||..         ...:....|:.
  Rat   348 KSIPTLISRLPVVSSVACGASV-------GYAVSKDGRVFAWGMG---------TNYQLGTGQED 396

  Fly  1390 EENQQRELLSKQLE 1403
            :.....|:..||||
  Rat   397 DAWSPVEMTGKQLE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 67/276 (24%)
RCC1_2 1175..1200 CDD:290274 10/25 (40%)
RCC1 1193..1240 CDD:278826 14/66 (21%)
RCC1 1242..1291 CDD:278826 19/53 (36%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
Rcc1XP_006239135.1 ATS1 19..432 CDD:227511 82/339 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.