DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and HERC6

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:517 Identity:112/517 - (21%)
Similarity:189/517 - (36%) Gaps:163/517 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1155 PPEPAHAVKSL--DLLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLGIGRHMQMALQP 1216
            |.||..|:::|  ||:|          ||::|:|.:.:.| :::.|..:..|||||...:::..|
Human    77 PKEPIQALETLIVDLVS----------CGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTP 131

  Fly  1217 MLVTALDGMNITMLEAGQYHNAAVA-DGKLYMWGWGIYGQLGQG-SCENIATPQLVSFFKFKKIL 1279
            ..:..|:.:.|..:..|.||:.|:: |.:::.||...:||||.| ...:.|:||.|...:...:.
Human   132 KKIMTLNDIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLA 196

  Fly  1280 QISLGHAHT--LVLCGAP----------------NSHMEAN----------------HCGN---- 1306
            |::.|.||:  |.|||..                |..:::|                .||:    
Human   197 QVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPVQSNKPLSVGALKNLGVVYISCGDAHTA 261

  Fly  1307 ------ELFVFGSNHFGQLG------------------------------------TG---NSDH 1326
                  ::|.||.|..||||                                    ||   :..|
Human   262 VLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGLVSQIDCGSYHTLAYVHTTGQVVSFGH 326

  Fly  1327 GDTKTNLPVRLEV----------------GDCSLRLIHTKFFTNLAVDEQDRLFTWG---SSPQA 1372
            |.:.|:.|...|.                .|..::.|....:.|.....||...|..   :.|:.
Human   327 GPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEI 391

  Fly  1373 LRLANQ-------IKRRANAKQKMEENQQRELLSKQLEATLLPAPIPSTSTLVEPTTSYAAVVAG 1430
            .|::..       :||| :.:.:|.:::.|.:.|         :|...|::.::...:      |
Human   392 SRISQSMAEKWIAVKRR-STEHEMAKSEIRMIFS---------SPACLTASFLKKRGT------G 440

  Fly  1431 STPKSSVSDTKDCQD-----VQNEAAPSDATETIAPASAKAAP---PPVPVASPPVLVPEPDPTE 1487
            .|....| |.:..:|     .:.|...|..|..:.....:|.|   |.....|..:|:|| .|..
Human   441 ETTSIDV-DLEMARDTFKKLTKKEWISSMITTCLEDDLLRALPCHSPHQEALSVFLLLPE-CPVM 503

  Fly  1488 H--------LTPHLVDTSEVAGRILQISSGLFHFCLISSSCTLYTWGK-----NLEHQLGTE 1536
            |        :.|......|::.:.||:....:.|...||...|....|     .|.||..||
Human   504 HDSKNWKNLVVPFAKAVCEMSKQSLQVLKKCWAFLQESSLNPLIQMLKAAIISQLLHQTKTE 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 110/514 (21%)
RCC1_2 1175..1200 CDD:290274 6/25 (24%)
RCC1 1193..1240 CDD:278826 12/46 (26%)
RCC1 1242..1291 CDD:278826 17/51 (33%)
RCC1_2 1503..1532 CDD:290274 8/33 (24%)
RCC1 1522..1568 CDD:278826 7/20 (35%)
RCC1_2 1558..1584 CDD:290274
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274 9/38 (24%)
RCC1 105..155 CDD:278826 13/49 (27%)
RCC1 158..208 CDD:278826 16/49 (33%)
RCC1 215..263 CDD:278826 4/47 (9%)
RCC1_2 250..279 CDD:290274 6/28 (21%)
RCC1 266..313 CDD:278826 8/46 (17%)
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.