DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and CG6678

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:228 Identity:59/228 - (25%)
Similarity:88/228 - (38%) Gaps:75/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1145 SYYSAQKSTEPPEPAH---------AVKS----------LDLLSQLNLQVHAIKCGRQHTLILTN 1190
            |.:.|.|:...|...|         |:.|          |...|:...:|..::||.:|.::|..
  Fly   127 SIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNA 191

  Fly  1191 NG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALDGMNITMLEAGQYHNAAV-ADGKLYMWGWGIY 1253
            || :::.||....|||:. .:::...|.|:.||.|:.||.:.||.:|:||: |.|.||.||....
  Fly   192 NGDVFTWGNGLRGQLGLA-ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCS 255

  Fly  1254 GQLG-------------------------------QGSCENIATPQLVSFFKFKKILQISLGHAH 1287
            ||||                               .|...:...|           |::..|..|
  Fly   256 GQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAP-----------LRVFAGSRH 309

  Fly  1288 TLVLCGAPNSHMEANHCGNELFVFGSNHFGQLG 1320
            ||::          ..|| .|:|.|....||||
  Fly   310 TLLI----------RRCG-RLWVSGWCKHGQLG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 55/215 (26%)
RCC1_2 1175..1200 CDD:290274 9/25 (36%)
RCC1 1193..1240 CDD:278826 16/46 (35%)
RCC1 1242..1291 CDD:278826 16/79 (20%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 59/228 (26%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 18/49 (37%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.