DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and Als2

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster


Alignment Length:163 Identity:43/163 - (26%)
Similarity:71/163 - (43%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1149 AQKSTEPPEPAHAVKSLDLLSQLNLQVHAIKCGRQHTL----ILTNNGLYSLGNNNLCQLGIGRH 1209
            |....||.:...:|||:    .......::....:|.|    .|.:..|::.|.:|...||.|.|
  Fly   215 ASAKEEPEDERASVKSI----SSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDH 275

  Fly  1210 MQMALQPMLVTALDGMNITMLEAGQYHNAA-VADGKLYMWGWGIYGQLGQGSCENIATPQLVSF- 1272
            ::.| ..|.:..||.|.:..:.||..|..| ..||:||.||...:.|||    |::::|..::. 
  Fly   276 IRRA-NVMRLQKLDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITIT 335

  Fly  1273 -------FKFKKILQISLGHAHTLVLCGAPNSH 1298
                   .:....|:.:.|..|||:|..:...|
  Fly   336 ENTAALPIEQNSALEATCGDYHTLLLNASGQIH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 40/154 (26%)
RCC1_2 1175..1200 CDD:290274 5/28 (18%)
RCC1 1193..1240 CDD:278826 16/47 (34%)
RCC1 1242..1291 CDD:278826 16/56 (29%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
Als2NP_649347.1 RCC1 258..304 CDD:278826 15/46 (33%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 16/56 (29%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.