DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and Rcbtb1

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_001101850.1 Gene:Rcbtb1 / 361050 RGDID:1308467 Length:531 Species:Rattus norvegicus


Alignment Length:289 Identity:80/289 - (27%)
Similarity:121/289 - (41%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1101 FRINYE------DNQF--------AIESSRFKPISAGCA--YCACVVDGTAYFWGSSGIPSYYSA 1149
            |.:||.      |||.        |:...|.|.:|.|..  ......||..|.||.:|. |....
  Rat    46 FGLNYSNCLGTGDNQSTLVPKKLEALCGKRIKSLSYGSGPHVLLSTEDGVVYAWGHNGY-SQLGN 109

  Fly  1150 QKSTEPPEPAHAVKSLDLLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLGIGRHMQMA 1213
            ..:.:...|.....:|     |..||..:.||..|::.|..:| |::.|.||..|:|.|......
  Rat   110 GTTNQGIAPIQVCTNL-----LVKQVVEVACGSHHSMALAADGELFAWGYNNCGQVGSGSTANQP 169

  Fly  1214 LQPMLVTALDGMNITMLEAGQYHNAAVAD-GKLYMWGWGIYGQLGQGSCENIATPQLVSFFKFKK 1277
            ....:...|....:..:..||..:.||.| |::|.||:...||||.|:..|..||..|:......
  Rat   170 TPRKVTNCLHTKKVVNIACGQTSSMAVLDSGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHGVC 234

  Fly  1278 ILQISLGHAHTLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTKTNLPVR----LE 1338
            :.||..|:||||.|...           ..|:.:|:|.:||||||:.::..:.|.:.|.    :|
  Rat   235 VNQIVCGYAHTLALTDE-----------GLLYAWGANTYGQLGTGSKNNLLSPTQIMVEKERVIE 288

  Fly  1339 VGDCSLRLIHTKFFTNLAVDEQDRLFTWG 1367
            :..|     |:. .|:.|..:...::.||
  Rat   289 IAAC-----HST-HTSAAKTQGGHVYMWG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 62/216 (29%)
RCC1_2 1175..1200 CDD:290274 8/25 (32%)
RCC1 1193..1240 CDD:278826 10/46 (22%)
RCC1 1242..1291 CDD:278826 21/49 (43%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
Rcbtb1NP_001101850.1 RCC1 42..89 CDD:395335 11/42 (26%)
ATS1 <91..363 CDD:227511 69/244 (28%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.