DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and Rcbtb2

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:124/277 - (44%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 DNQFAIESSRFKPIS----AGCAY------CACVVDGTAYFWGSSGIPSYYSAQKSTEPPEPAHA 1161
            |.|..||..|...::    |..:|      .....||..:.||.:.. |......:.....|.|.
  Rat   116 DIQSTIEPRRLDSLTGKKIASLSYGSGPHIVLATTDGEVFTWGHNAY-SQLGNGTTNHGLVPCHI 179

  Fly  1162 VKSLDLLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALDGM 1225
            ..:|.     |.||..:.||..|:|:||::| :::.|.||..|:|.|......:...:...|...
  Rat   180 STNLS-----NKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTANQPIPRRVTGCLQNK 239

  Fly  1226 NITMLEAGQYHNAAVAD-GKLYMWGWGIYGQLGQGSCENIATPQLVSFFKFKKILQISLGHAHTL 1289
            .:..:..||..:.||.| |::|:||:...||||.||..|..||..|:..:..::.:::.|:||||
  Rat   240 VVMSIACGQMCSMAVVDTGEVYVWGYNGNGQLGLGSSGNQPTPCRVAALQGIRVQRVACGYAHTL 304

  Fly  1290 VLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTKTNLPVR----LEVGDCSLRLIHTK 1350
            ||...           .:::.:|:|.:|||||||..:....|.:.|.    :|:..|     |:.
  Rat   305 VLTDE-----------GQIYAWGANSYGQLGTGNKSNQSYPTPVVVEKDRIIEIAAC-----HSA 353

  Fly  1351 FFTNLAVDEQDRLFTWG 1367
             .|:.|..:...::.||
  Rat   354 -HTSAAKSQGGHVYMWG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 64/216 (30%)
RCC1_2 1175..1200 CDD:290274 9/25 (36%)
RCC1 1193..1240 CDD:278826 9/46 (20%)
RCC1 1242..1291 CDD:278826 20/49 (41%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 69/252 (27%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.