DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and Rccd1

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_775621.2 Gene:Rccd1 / 269955 MGIID:2444156 Length:377 Species:Mus musculus


Alignment Length:312 Identity:73/312 - (23%)
Similarity:112/312 - (35%) Gaps:101/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1120 ISAGCAYCACV---------------VDGTAYFW-------------GSS-------------GI 1143
            :|||.:|.|.|               .||....|             |||             |.
Mouse    45 VSAGWSYTALVTRGGRVELSGSVSGAADGCRDVWASEELLVLLRNKGGSSTEVQAWVPGSALQGE 109

  Fly  1144 P----SYYSAQKSTEPPEPAHAVK--SLDLLS----------------QLNLQVHAIKCGRQHTL 1186
            |    :..|..|.....||:...:  :|.||.                ...|:|..::.|.:|.|
Mouse   110 PLWVQNLVSGAKGQGEDEPSRESRMGTLPLLPCARAYVTPEPPFCQPLAPELRVRQLELGAEHVL 174

  Fly  1187 ILTNNG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALDGMNITMLEAGQYHNAAVAD-GKLYMWG 1249
            :|...| ::|.|.....|||.|. ::..|:|.|:.||.|:.:..:.||.:|:..::: |.:|:||
Mouse   175 LLCAAGQVFSWGAGRHGQLGHGT-LEAELEPRLLEALQGLRMAKVAAGGWHSVCLSETGDIYIWG 238

  Fly  1250 WGIYGQLG---------------------QGSCENIAT------PQLVSFFKFKKILQISLGHAH 1287
            |...|||.                     .|..|.:|.      ...::...|..:|.:.||...
Mouse   239 WNESGQLALPTRSGTENKAEREEATELNEDGLKEELAVADAGAPAHFIAIQPFPALLDLPLGSDA 303

  Fly  1288 TLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGD-TKTNLPVRLE 1338
            .:..||  :.|........||:.:|...:||||     |.| |..:.|..:|
Mouse   304 VMASCG--SRHTAVVTRTGELYTWGWGKYGQLG-----HKDSTSLDRPCCVE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 56/229 (24%)
RCC1_2 1175..1200 CDD:290274 8/25 (32%)
RCC1 1193..1240 CDD:278826 15/46 (33%)
RCC1 1242..1291 CDD:278826 15/76 (20%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
Rccd1NP_775621.2 Interaction with KDM8. /evidence=ECO:0000250|UniProtKB:A6NED2 1..172 24/126 (19%)
ATS1 <159..341 CDD:227511 50/189 (26%)
RCC1 2 179..230 16/51 (31%)
RCC1 3 232..289 11/56 (20%)
RCC1 4 319..372 12/35 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.