Sequence 1: | NP_001287593.1 | Gene: | ca / 43518 | FlyBaseID: | FBgn0000247 | Length: | 1961 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775621.2 | Gene: | Rccd1 / 269955 | MGIID: | 2444156 | Length: | 377 | Species: | Mus musculus |
Alignment Length: | 312 | Identity: | 73/312 - (23%) |
---|---|---|---|
Similarity: | 112/312 - (35%) | Gaps: | 101/312 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1120 ISAGCAYCACV---------------VDGTAYFW-------------GSS-------------GI 1143
Fly 1144 P----SYYSAQKSTEPPEPAHAVK--SLDLLS----------------QLNLQVHAIKCGRQHTL 1186
Fly 1187 ILTNNG-LYSLGNNNLCQLGIGRHMQMALQPMLVTALDGMNITMLEAGQYHNAAVAD-GKLYMWG 1249
Fly 1250 WGIYGQLG---------------------QGSCENIAT------PQLVSFFKFKKILQISLGHAH 1287
Fly 1288 TLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGD-TKTNLPVRLE 1338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ca | NP_001287593.1 | ATS1 | 1158..1588 | CDD:227511 | 56/229 (24%) |
RCC1_2 | 1175..1200 | CDD:290274 | 8/25 (32%) | ||
RCC1 | 1193..1240 | CDD:278826 | 15/46 (33%) | ||
RCC1 | 1242..1291 | CDD:278826 | 15/76 (20%) | ||
RCC1_2 | 1503..1532 | CDD:290274 | |||
RCC1 | 1522..1568 | CDD:278826 | |||
RCC1_2 | 1558..1584 | CDD:290274 | |||
Rccd1 | NP_775621.2 | Interaction with KDM8. /evidence=ECO:0000250|UniProtKB:A6NED2 | 1..172 | 24/126 (19%) | |
ATS1 | <159..341 | CDD:227511 | 50/189 (26%) | ||
RCC1 2 | 179..230 | 16/51 (31%) | |||
RCC1 3 | 232..289 | 11/56 (20%) | |||
RCC1 4 | 319..372 | 12/35 (34%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833506 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |