DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and K11D2.1

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:148 Identity:37/148 - (25%)
Similarity:65/148 - (43%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1175 VHAIKCGRQHTLIL---TNNGLYSLGNNNLCQLGIGRHMQMALQPMLVTALDGMNITMLEAGQYH 1236
            |..::....|..::   |...|:|:|.....:||:|. ::...:|:.:..|.|:.|..:..|.:|
 Worm   131 VRIVEAAAGHDFLIFRDTTGNLFSMGTGTRGELGVGL-IRRVDEPVHIEQLVGIRIKKVACGGWH 194

  Fly  1237 NAAVAD-GKLYMWGWGIYGQLGQGSCENIATPQLV----SFFKFKKILQISLGHAHTLVLCGAPN 1296
            ..|:.: |..|.|||..|||||:........|.|:    ..|..:.||.::....:|.::.    
 Worm   195 TVALTEGGDAYTWGWNRYGQLGKDKGSTEVYPVLIDPEEEKFGEENILDVACTEHNTQIVI---- 255

  Fly  1297 SHMEANHCGNELFVFGSN 1314
                  ..|:..||.|:|
 Worm   256 ------KTGHAPFVLGTN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 37/148 (25%)
RCC1_2 1175..1200 CDD:290274 6/27 (22%)
RCC1 1193..1240 CDD:278826 12/46 (26%)
RCC1 1242..1291 CDD:278826 16/53 (30%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 32/138 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.