DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and RCBTB2

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_016875858.1 Gene:RCBTB2 / 1102 HGNCID:1914 Length:561 Species:Homo sapiens


Alignment Length:363 Identity:87/363 - (23%)
Similarity:146/363 - (40%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1051 SHNSDCAMSNDNNPQ---------------LFEFCKSLIETYLAVLIHMESQRVKYDSIVNALSN 1100
            ||:..|:::|....|               :|..|.   |..|.::    .|...:.|..|.:..
Human    13 SHSFTCSLTNTKPVQATLSSLKMLDVGKWPIFSLCS---EEELQLI----RQACVFGSAGNEVLY 70

  Fly  1101 FRINYE---------------DNQFAIESSRFKPISAGCAYC----------ACVVDGTAYFWGS 1140
            ..:|.|               |.|..||..|...::.....|          ....:|..:.||.
Human    71 TTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGH 135

  Fly  1141 SGIPSYYSAQKSTEPPEPAHAVKSLDLLSQLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQL 1204
            :.. |......:.....|.|...:|.     |.||..:.||..|:|:||::| :::.|.||..|:
Human   136 NAY-SQLGNGTTNHGLVPCHISTNLS-----NKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQV 194

  Fly  1205 GIGRHMQMALQPMLVTALDGMNITMLEAGQYHNAAVAD-GKLYMWGWGIYGQLGQGSCENIATPQ 1268
            |.|..:...:...:...|....:..:..||....||.| |::|:||:...||||.|:..|..||.
Human   195 GSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPC 259

  Fly  1269 LVSFFKFKKILQISLGHAHTLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTKTNL 1333
            .|:..:..::.:::.|:||||||...           .:::.:|:|.:|||||||..:....|.:
Human   260 RVAALQGIRVQRVACGYAHTLVLTDE-----------GQVYAWGANSYGQLGTGNKSNQSYPTPV 313

  Fly  1334 PVR----LEVGDCSLRLIHTKFFTNLAVDEQDRLFTWG 1367
            .|.    :|:..|     |:. .|:.|..:...::.||
Human   314 TVEKDRIIEIAAC-----HST-HTSAAKTQGGHVYMWG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 63/216 (29%)
RCC1_2 1175..1200 CDD:290274 9/25 (36%)
RCC1 1193..1240 CDD:278826 9/46 (20%)
RCC1 1242..1291 CDD:278826 19/49 (39%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
RCBTB2XP_016875858.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.