DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and LOC100536575

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_009295984.1 Gene:LOC100536575 / 100536575 -ID:- Length:409 Species:Danio rerio


Alignment Length:395 Identity:97/395 - (24%)
Similarity:136/395 - (34%) Gaps:132/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 SMDYFAFIQEKLHHIRPCVLQRLSKQLNPFSPALRPIVSHNSDCAMSNDNNPQLF--EFCKSLIE 1075
            ||.:|.|                  ..|.|....|..||....|.:   |:|.|.  :.|||.:.
Zfish    33 SMSWFGF------------------GFNGFGQISRADVSGQVKCKV---NSPVLISDDECKSGVN 76

  Fly  1076 TYLAVLIHMESQRVKYDSIVNALSNFRINYEDNQFAIESSRFKPISAGCAYCACVVDGTAYFWGS 1140
                          :.|..:.|..:.|.:.:..|          ..:|.....||...:|....|
Zfish    77 --------------RSDRRIRACWSSRADLQQTQ----------SGSGVYLSGCVCGPSAQVCAS 117

  Fly  1141 SG-----IPSYYSAQKSTEPPE-------------------PAHAVKSLDLLS------------ 1169
            .|     |...:.....|:..|                   .|....:|.|:|            
Zfish   118 QGCTDALISETHLTLSFTDRVELWEIKPQQNQLVWKREHELSAEHTAALPLVSGGFVQHKPPFFH 182

  Fly  1170 QLNLQVHAIKCGRQHTLILTNNG-LYSLGNNNLCQLGIGRHMQMALQ-PMLVTALDGMNITMLEA 1232
            .|.|...::..|.:|.|:||.:| |||.|:.:..|||.|  :..:|: |..|.||.|:.|..:.|
Zfish   183 PLKLCAVSLVLGSEHALLLTADGTLYSWGSGSHGQLGHG--VLTSLEDPQAVEALWGVPIKAVAA 245

  Fly  1233 GQYHNAAVAD-GKLYMWGWGIYGQL-------------GQGSCEN------------------IA 1265
            |.:|:|||:. |.||||||...|||             |.||..:                  .|
Zfish   246 GNWHSAAVSSGGDLYMWGWNESGQLGLPSRGLEEEKRRGNGSGNDDQPINTDGKSRTDVFISIQA 310

  Fly  1266 TPQLVSFFKFKKILQISLGHAHTLVLCGAPNSHMEANHCGNELFVFGSNHFGQLGTGNSDHGDTK 1330
            .|.||......:|.:||.|..||..:..|           .:|:.:|...:||||.|.....|..
Zfish   311 FPALVDIANMSEISRISCGSRHTAAVTSA-----------GDLYTWGWGQYGQLGHGTEHSTDEP 364

  Fly  1331 TNLPV 1335
            |  ||
Zfish   365 T--PV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 68/224 (30%)
RCC1_2 1175..1200 CDD:290274 10/25 (40%)
RCC1 1193..1240 CDD:278826 19/47 (40%)
RCC1 1242..1291 CDD:278826 23/80 (29%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
LOC100536575XP_009295984.1 RCC1_2 189..217 CDD:290274 10/27 (37%)
RCC1 204..253 CDD:278826 20/50 (40%)
RCC1_2 240..269 CDD:290274 14/28 (50%)
RCC1 257..336 CDD:278826 23/78 (29%)
RCC1_2 323..352 CDD:290274 9/39 (23%)
RCC1 340..389 CDD:278826 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.