DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ca and rccd1

DIOPT Version :9

Sequence 1:NP_001287593.1 Gene:ca / 43518 FlyBaseID:FBgn0000247 Length:1961 Species:Drosophila melanogaster
Sequence 2:XP_012813982.2 Gene:rccd1 / 100135212 XenbaseID:XB-GENE-877111 Length:411 Species:Xenopus tropicalis


Alignment Length:215 Identity:55/215 - (25%)
Similarity:94/215 - (43%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1148 SAQKSTEP--------PEPAHAVKSLDLLSQLNLQVHAIK--CGRQHTLILTNNGLYSLGNNNLC 1202
            ||..|..|        |:|       ....:|..::||.|  .|.:|.::||:       ...:.
 Frog   171 SAHNSLFPLVTNGYIVPKP-------PFFRELPSKIHARKLALGNEHAVLLTS-------ELTVL 221

  Fly  1203 QLGIGRHMQM-------ALQPMLVTALDGMNITMLEAGQYHNAAVAD-GKLYMWGWGIYGQLGQG 1259
            ..|.|||.|:       ..:|.:|.||.|:.::.:.||.:|:|.::: |.:|.|||...||||. 
 Frog   222 TWGAGRHGQLGHGDLEDVEEPQIVDALHGVPMSEVAAGGWHSAGISESGDIYTWGWNESGQLGL- 285

  Fly  1260 SCE----NIATPQ------------LVSFFKFKKILQISLGHAHTLVLCGAPNSHMEANHCGNEL 1308
            .|:    :::|.|            .::...|..::.:......:.:.||  :.|..|.....||
 Frog   286 PCKTQQCSVSTKQSHKEDEMGNTGEFITIQAFPALIDLPQESEASKISCG--SRHTAAVSRSGEL 348

  Fly  1309 FVFGSNHFGQLGTGNSDHGD 1328
            :.:|...:||||.|::|..|
 Frog   349 YSWGWGKYGQLGHGDTDSLD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caNP_001287593.1 ATS1 1158..1588 CDD:227511 50/197 (25%)
RCC1_2 1175..1200 CDD:290274 7/26 (27%)
RCC1 1193..1240 CDD:278826 14/53 (26%)
RCC1 1242..1291 CDD:278826 13/65 (20%)
RCC1_2 1503..1532 CDD:290274
RCC1 1522..1568 CDD:278826
RCC1_2 1558..1584 CDD:290274
rccd1XP_012813982.2 ATS1 <201..373 CDD:227511 47/178 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.