DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and AT5G27950

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_198147.2 Gene:AT5G27950 / 832864 AraportID:AT5G27950 Length:625 Species:Arabidopsis thaliana


Alignment Length:386 Identity:140/386 - (36%)
Similarity:217/386 - (56%) Gaps:33/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 HLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRM 366
            |...:.|:.:...|::..||   |.:|...:.:||::.|.::|.:|:||||||:||.|.:|...:
plant    36 HESNQLEKSISNLEEEVFEL---KLKLKSLDEKRKQVLNKIIDTKGSIRVFCRVRPFLLTERRPI 97

  Fly   367 CCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIF 431
            ....::..::.|    |.:...||.    |.||:|||..::|.::|..|.|:::|||||:|:|:.
plant    98 REPVSFGPDNVV----IRSAGSSKE----FEFDKVFHQSATQEEVFGEVKPILRSALDGHNVCVL 154

  Fly   432 AYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYEI--KATFLEIYNEVLYDLLS 494
            ||||||:|||:||||..|..|:.||.:..||:.    .::...:.:  :.:.||||...|.||||
plant   155 AYGQTGTGKTFTMDGTSEQPGLAPRAIKELFNE----ASMDQTHSVTFRMSMLEIYMGNLKDLLS 215

  Fly   495 NEQ--KDME------IRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSS 551
            ..|  |..|      :.:..::|..:.:..:||..|:|....|...:..:..|:|:.|..||.||
plant   216 ARQSLKSYEASAKCNLNIQVDSKGSVEIEGLTEVEVMDFTKARWWYNKGRRVRSTSWTNVNETSS 280

  Fly   552 RSHAVTKLELIGR-HAEKQEISVGSINLVDLAGSES-PKTST---RMTETKNINRSLSELTNVIL 611
            |||.:|::.:..| .|...:..|..:.::||.|||. .||..   .|.|.:.||.|||.|.:||.
plant   281 RSHCLTRITIFRRGDAVGSKTEVSKLWMIDLGGSERLLKTGAIGQTMDEGRAINLSLSALGDVIA 345

  Fly   612 ALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRF---AASVNS 669
            ||.:|:.|:||||||||.:|..|||..||.||.:::||..:...|::.||.|   |.:|.|
plant   346 ALRRKKGHVPYRNSKLTQILKDSLGTRSKVLMLVHISPRDEDVGETICSLSFTKRARAVES 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 129/342 (38%)
KISc 348..678 CDD:214526 128/340 (38%)
AT5G27950NP_198147.2 Motor_domain 77..405 CDD:277568 127/339 (37%)
Kinesin 85..404 CDD:278646 121/330 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D364605at2759
OrthoFinder 1 1.000 - - FOG0000325
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.