DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and kif15

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_002666969.1 Gene:kif15 / 573988 ZFINID:ZDB-GENE-050622-16 Length:1376 Species:Danio rerio


Alignment Length:391 Identity:137/391 - (35%)
Similarity:200/391 - (51%) Gaps:61/391 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 MDLRGN-------------IRVFCRIRP-----PLESEENRMCCTWTYHDESTVELQSIDAQAKS 389
            |:|:|.             |:||.|:||     .|.::.:...|. |.....||.|.       .
Zfish     1 MNLKGKATAEANTNSDGDAIKVFVRVRPLTQGTGLSTDGDHSLCL-TVSSPQTVRLH-------C 57

  Fly   390 KMGQQIFSFDQVFHPLSSQSDIFEMVSP-LIQSALDGYNICIFAYGQTGSGKTYTMDGVPESV-- 451
            |...:.|::|.|....:||.::|..|:. :::|.::|||..||||||||||||:||.| |..:  
Zfish    58 KPEPRTFTYDHVADMNTSQEEVFSSVAKNIVESCMNGYNGTIFAYGQTGSGKTFTMLG-PSELDN 121

  Fly   452 ------GVIPRTVDLLFDSI-RGYRNLGW--EYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKN 507
                  |||||:.:.||..| |.....|.  .:..|.:|:|||||.:||||.:....:.:|  ::
Zfish   122 FSDELRGVIPRSFEYLFFLINREVERSGGTKSFLCKCSFIEIYNEQIYDLLDSVSTSLFLR--ED 184

  Fly   508 NKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEIS 572
            .|..::|....|:..........::.....||..|||:.|..|||||||..:.|..:...::.::
Zfish   185 IKRGVFVEGSVEKYAASAAEAYQVLSMGWRNRRVASTSMNRESSRSHAVFTMTLESKETGQEVVN 249

  Fly   573 V--GSINLVDLAGSESPKTS----TRMTETKNINRSLSELTNVILALLQ----KQDHIPYRNSKL 627
            :  ..:|||||||||..:.:    :|:.|..:|||||..|..||:||:.    |..||.||:|||
Zfish   250 IRTSQLNLVDLAGSERQRDTHTEGSRLKEASSINRSLMCLGQVIMALMDVSNGKNRHICYRDSKL 314

  Fly   628 THLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSSTQS 692
            |.||..|||||:||.:..||.|...||.|::.:|:||   ...|:.|       |.::.|..||.
Zfish   315 TFLLRDSLGGNAKTYIIANVHPGSKCFGETLSTLQFA---QRAKLIK-------NKAMVNEDTQG 369

  Fly   693 N 693
            |
Zfish   370 N 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 128/365 (35%)
KISc 348..678 CDD:214526 129/369 (35%)
kif15XP_002666969.1 KISc_KLP2_like 18..367 CDD:276824 131/369 (36%)
KISc 19..364 CDD:214526 130/365 (36%)
SbcC 371..1007 CDD:223496 137/391 (35%)
Kinesin-relat_1 462..547 CDD:289481
Ax_dynein_light <602..658 CDD:287215
GBP_C <707..805 CDD:303769
Mplasa_alph_rch 709..1360 CDD:275316
coiled coil 776..788 CDD:293879
coiled coil 794..805 CDD:293879
HMMR_C 1262..>1372 CDD:292530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.