DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and cmet

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster


Alignment Length:355 Identity:113/355 - (31%)
Similarity:180/355 - (50%) Gaps:40/355 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIF 412
            :|:|..::||.    |..:...|...:..::.|....|:.        :.||.||...:|..::|
  Fly     8 SIQVCIKVRPC----EPGLTSLWQVKERRSIHLADSHAEP--------YVFDYVFDEGASNQEVF 60

  Fly   413 E-MVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYE 476
            : |...::.:.:.|:|..|||||||.|||||||.|..::.||:......:|..|......  ::.
  Fly    61 DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER--DFL 123

  Fly   477 IKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRAT 541
            ::..::|||||.:||||:.:.:|::|.   .:.|.|...|..|..:.....|..|:......|..
  Fly   124 LRVGYIEIYNEKIYDLLNKKNQDLKIH---ESGNGIVNVNCEECIITSEVDLLRLLCLGNKERTV 185

  Fly   542 ASTAGNERSSRSHAVTKLELIGR---HAEKQEISVGSINLVDLAGSE----SPKTSTRMTETKNI 599
            ..|..|||||||||:.|:.:..|   |::...:....:|||||||||    :.....|:.|..:|
  Fly   186 GETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEGGHI 250

  Fly   600 NRSLSELTNVILALLQKQDH--IPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLR 662
            |:||..|:|||.:|.:..|:  ..||:||||.:|..|||||:.|.:...:.|  ...:||..:|.
  Fly   251 NKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKP--SIMEESQSTLS 313

  Fly   663 FAASVNSCKMTKAKRNR---YLNNSVANSS 689
            ||        |:||:.|   .:|..|::::
  Fly   314 FA--------TRAKKIRIKPQVNEMVSDAT 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 107/333 (32%)
KISc 348..678 CDD:214526 110/339 (32%)
cmetNP_524993.3 KISc 8..328 CDD:214526 111/346 (32%)
Motor_domain 8..321 CDD:277568 110/339 (32%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.