DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and sub

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:440 Identity:112/440 - (25%)
Similarity:185/440 - (42%) Gaps:103/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 TEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWT 371
            ||...:....:|.|..:|......|:           ::....:||.|:||..::.:     .:.
  Fly    57 TESEYKYQSSEATEGASCATSAADSS-----------NVETGPQVFLRLRPVKDASK-----AYI 105

  Fly   372 YHDESTVELQSIDAQAKSKMGQQI---FSFDQVFHPLSSQSDIFE-MVSPLIQSALDGYNICIFA 432
            ..:|:.|.:.|....:.|....::   |.|..:|.....|.||:: .|.|.|   ::...:.|..
  Fly   106 VSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMT 167

  Fly   433 YGQTGSGKTYTMDGVPESVGVIPRTVDLLF----DSIRGYRNLGWE------------------- 474
            ||.:|||||||:.|.....|:|||.::.:|    |::  :|:...:                   
  Fly   168 YGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTV--FRSPKLKLINGSIVFLQDDASLKELQ 230

  Fly   475 ----------------------------YEIKA----------TFLEIYNEVLYDLLSNEQKDME 501
                                        :|.||          :|:|||||::||||:...|..:
  Fly   231 IRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDK 295

  Fly   502 IRMA--KN-----NKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKL 559
            :...  ||     ||..:::..:|...|........|:...:.....|||:.|..|||||.|..:
  Fly   296 LGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV 360

  Fly   560 ELIGRHAEKQEISVGSINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVI--LALLQKQ- 617
            ::: ::......:..|....||||||    :..:..|:.|.||||.||..|...:  .:.:||: 
  Fly   361 DIL-KYNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKK 424

  Fly   618 --DHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAA 665
              |.||||:||||.||..:|.|..|..|.:.|:|....::|::..|.||:
  Fly   425 NADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFAS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 106/401 (26%)
KISc 348..678 CDD:214526 106/399 (27%)
subNP_001286548.1 KISc 89..477 CDD:276812 106/397 (27%)
Kinesin 93..479 CDD:278646 104/393 (26%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.