DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp68D

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster


Alignment Length:354 Identity:129/354 - (36%)
Similarity:194/354 - (54%) Gaps:29/354 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 IRVFCRIRPPLESEENRMC--CTWTYHDESTVELQS-IDAQAKSKMGQQIFSFDQVFHPLSSQSD 410
            ::|..|.||....|.:...  ....|.:...||||: :|.   :|..:::|::|..:...::|:.
  Fly    20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDG---NKEQRKVFTYDAAYDASATQTT 81

  Fly   411 IF-EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGV---PESVGVIPRTVDLLFDSIRGYRNL 471
            :: |:|.||:.|.|:|:|.|||||||||:|||:||:||   .|.:|:||||.:.::..|.  |..
  Fly    82 LYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHIN--RTE 144

  Fly   472 GWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAK 536
            .:::.:..::||||.|.|.|||....|.:|:|   ...:.:||.|:..........:..:|....
  Fly   145 NFQFLVDVSYLEIYMEELRDLLKPNSKHLEVR---ERGSGVYVPNLHAINCKSVEDMIKVMQVGN 206

  Fly   537 MNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSE-SPKT---STRMTETK 597
            .||....|..||.||||||:..:::.....|...|.||.:||:|||||| ..||   :.|:.|..
  Fly   207 KNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEAS 271

  Fly   598 NINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLR 662
            .||.:||.|.|||.||.:...|:|||:||||.||..||||||||:|..|:.|....:.|::.:||
  Fly   272 KINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLR 336

  Fly   663 FAASVNSCKMTKAKRNRYLNNSVANSSTQ 691
            :|:...|.:          |..:.|...|
  Fly   337 YASRAKSIQ----------NQPIKNEDPQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 126/333 (38%)
KISc 348..678 CDD:214526 126/339 (37%)
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 125/331 (38%)
KISc 20..351 CDD:214526 127/348 (36%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.