DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp64D

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster


Alignment Length:376 Identity:128/376 - (34%)
Similarity:200/376 - (53%) Gaps:29/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIF 412
            |:||..|.||..::|.:....:....|:....:..:...|.:....:.:.||.||...|:|.|::
  Fly    20 NVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLY 84

  Fly   413 -EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPES---VGVIPRTVDLLFDSIRGYRNLGW 473
             :...|::...|:|||..|.||||||:||||||.|.|:|   .|:||.....:|..|...:. ..
  Fly    85 VDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKE-NQ 148

  Fly   474 EYEIKATFLEIYNEVLYDLLSNE-QKDMEIRMAKNNKNDI--YVSNITEETVLDPNHLRHLMHTA 535
            ::.::.:::|||||.:.|||..: .|.:|::    .:.||  :|.:::...|.:.:.|.::|...
  Fly   149 KFLVRVSYMEIYNEEVRDLLGKDVGKSLEVK----ERPDIGVFVKDLSGYVVHNADDLENIMRLG 209

  Fly   536 KMNRATASTAGNERSSRSHAVTKLEL----IGRHAEKQEISVGSINLVDLAGSE-SPKTST---R 592
            ..|||..:|..|:.||||||:..:.:    :| ..:.|.:.:|.:.|||||||| ..||..   |
  Fly   210 NKNRAVGATKMNQESSRSHAIFSITVERSELG-EGDVQHVRMGKLQLVDLAGSERQSKTQASGQR 273

  Fly   593 MTETKNINRSLSELTNVILALLQ-KQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQE 656
            :.|...||.|||.|.|||.||:. |..||||||||||.||..||||||||:|...:||....:.|
  Fly   274 LKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYME 338

  Fly   657 SVKSLRFAASV----NSCKMTKAKRN---RYLNNSVANSSTQSNNSGSFDK 700
            ::.:||:|:..    |...:.:..::   |:....:|....|.....|.::
  Fly   339 TISTLRYASRAKNIQNRMHINEEPKDALLRHFQEEIARLRKQLEEGDSLEE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 124/343 (36%)
KISc 348..678 CDD:214526 124/349 (36%)
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 123/337 (36%)
Kinesin 26..352 CDD:278646 120/331 (36%)
RILP-like <437..556 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.