DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and pav

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_477025.1 Gene:pav / 38515 FlyBaseID:FBgn0011692 Length:887 Species:Drosophila melanogaster


Alignment Length:463 Identity:120/463 - (25%)
Similarity:196/463 - (42%) Gaps:114/463 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 KELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSID---AQAKSKMGQQ--- 394
            |:..:|....|..:.||||:| ||:|:.:  ..:....:.:|:.|...|   ...|...|.|   
  Fly    24 KQRRDTSDKARDPVNVFCRVR-PLQSDAD--LTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREV 85

  Fly   395 IFSFDQVFHPLSSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTV 458
            .:.|..||.|.::|.|::..|: ||:::.|.|.|..:|.||.|||||||||.|.....|::||.:
  Fly    86 QYIFKHVFQPDATQQDVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCL 150

  Fly   459 DLLF---------------DSIRGYRNLGWE---------------------------------- 474
            |:||               |.:.|:..|..|                                  
  Fly   151 DVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGRFAFRHKDSDPEIASQ 215

  Fly   475 ----------------YEIKATFLEIYNEVLYDLL--SNEQKDMEIRMAKNNKN-DIYVSNITEE 520
                            |.:..|::||||..:||||  |..||.::.::.:.:.| .::|..:||.
  Fly   216 ASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLLEDSGIQKTLQSKIIREDANRHMFVHGVTEV 280

  Fly   521 TVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELI-------GRHA--EKQEISVGSI 576
            .|........:....:..:....|..|..|||||:|..:.|:       |.:.  ::|.|:|..:
  Fly   281 EVKTVEDALEVFQMGQKRKRMGHTVLNAESSRSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQL 345

  Fly   577 NLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVILALLQKQ---------DHIPYRNSKLT 628
            :||||||||    :..|..|:.|..|||.||..|...:..|.:.|         ..:|||:||:|
  Fly   346 SLVDLAGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPKKVPYRDSKIT 410

  Fly   629 HLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKA--------------KRNR 679
            |:......|..:..|.:.::|..:.:.|:::.::||......::.:|              |.|:
  Fly   411 HMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKFAEMTQEVQIARATPMKQDLGLTPGRRKANK 475

  Fly   680 YLNNSVAN 687
            ....:|.|
  Fly   476 LFKIAVNN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 113/422 (27%)
KISc 348..678 CDD:214526 114/440 (26%)
pavNP_477025.1 KISc_KIF23_like 35..450 CDD:276819 112/417 (27%)
Kinesin 42..452 CDD:278646 109/412 (26%)
MKLP1_Arf_bdg 735..837 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.