DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp61F

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster


Alignment Length:385 Identity:135/385 - (35%)
Similarity:198/385 - (51%) Gaps:70/385 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 MDLRG-------------NIRVFCRIRPPLESEENRMCCTWTYH------DESTVELQSIDAQAK 388
            ||:.|             ||:|:.|:| ||.|.|.   |..:..      ....|...::|::..
  Fly     1 MDISGGNTSRQPQKKSNQNIQVYVRVR-PLNSRER---CIRSAEVVDVVGPREVVTRHTLDSKLT 61

  Fly   389 SKMGQQIFSFDQVFHPLSSQSDIFE-MVSPLIQSALDGYNICIFAYGQTGSGKTYTMDG------ 446
            .|     |:||:.|.|.|.|.|::. :|||||:..|:|||..:|||||||:|||:||.|      
  Fly    62 KK-----FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAEL 121

  Fly   447 -----VPESVGVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAK 506
                 ....:|:|||.:..|||.:   |.:..||.::.::||:|||.|.||||.:. ..:||:..
  Fly   122 KSSWEDDSDIGIIPRALSHLFDEL---RMMEVEYTMRISYLELYNEELCDLLSTDD-TTKIRIFD 182

  Fly   507 NN--KNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQ 569
            ::  |..:.:..:.|..|...:.:..|:...|..|.||:|..|.:|||||.|..:.:   |..:.
  Fly   183 DSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVV---HIREN 244

  Fly   570 EI------SVGSINLVDLAGSES-----PKTSTRMTETKNINRSLSELTNVILALLQKQDHIPYR 623
            .|      .:|.:|||||||||:     .:...|:.||.|||:||..|..||.||:.:..|:|||
  Fly   245 GIEGEDMLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYR 309

  Fly   624 NSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFA---------ASVNSCKMTK 674
            .||||.||..||||.:||.:...:||.....:|::.:|.:|         ..||. |:||
  Fly   310 ESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQ-KLTK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 130/378 (34%)
KISc 348..678 CDD:214526 132/367 (36%)
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 129/364 (35%)
Kinesin 25..356 CDD:278646 124/346 (36%)
Microtub_bind 923..>1009 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.