DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and unc-104

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_611155.3 Gene:unc-104 / 36876 FlyBaseID:FBgn0267002 Length:1739 Species:Drosophila melanogaster


Alignment Length:376 Identity:127/376 - (33%)
Similarity:185/376 - (49%) Gaps:43/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENR-------MCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPL 405
            :::|..|:||....|..|       |....|......|...:.|:..:.......:|.|......
  Fly     3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDADF 67

  Fly   406 SSQSDIFEMV-SPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPE--SVGVIPRTVDLLFDSIRG 467
            |:||.:::.: ..::|.:.||||:|||||||||:||:|||.|..|  ..|:||.....||..|:.
  Fly    68 STQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQD 132

  Fly   468 YRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLM 532
            ......:|.::.:::|||.|.:.|||:.:.|. .:|:.::.....||.::::..|.|...:..|:
  Fly   133 TETDDLKYSVEVSYMEIYCERVRDLLNPKNKG-NLRVREHPLLGPYVEDLSKLAVTDYQDIHDLI 196

  Fly   533 HTAKMNRATASTAGNERSSRSHAVTKLELIGRH--------AEKQEISVGSINLVDLAGSESPKT 589
            ......|..|:|..||.|||||||..:....|.        .||    |..|:||||||||...:
  Fly   197 DEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEK----VSKISLVDLAGSERADS 257

  Fly   590 S----TRMTETKNINRSLSELTNVILALLQ---------KQDHIPYRNSKLTHLLMPSLGGNSKT 641
            :    ||:.|..|||:||:.|..||.||.:         |.|.||||:|.||.||..:|||||||
  Fly   258 TGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKT 322

  Fly   642 LMFINVSPFQDCFQESVKSLRFA--ASVNSCKM-----TKAKRNRYLNNSV 685
            .|...:||....:.|::.:||:|  |....||.     ..||..|.|...:
  Fly   323 AMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 122/356 (34%)
KISc 348..678 CDD:214526 125/367 (34%)
unc-104NP_611155.3 KISc_KIF1A_KIF1B 2..358 CDD:276816 123/359 (34%)
KISc 3..358 CDD:214526 123/359 (34%)
Kinesin_assoc 355..498 CDD:292801 4/19 (21%)
FHA 475..574 CDD:238017
KIF1B 878..923 CDD:289208
DUF3694 1246..1347 CDD:289256
PH_KIFIA_KIFIB 1602..1704 CDD:269939
PH 1607..1700 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.