DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Khc

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_476590.1 Gene:Khc / 36810 FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster


Alignment Length:362 Identity:137/362 - (37%)
Similarity:190/362 - (52%) Gaps:34/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIF 412
            :|:|.||.||..:||| :....:.....:.||...|....|      ::.||:||.|.:||..::
  Fly    12 SIKVVCRFRPLNDSEE-KAGSKFVVKFPNNVEENCISIAGK------VYLFDKVFKPNASQEKVY 69

  Fly   413 -EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGV-PESV--GVIPRTVDLLFDSIRGYR-NLG 472
             |....::...|.|||..|||||||.||||:||:|| .:||  |:|||.|:.:|:.|.... || 
  Fly    70 NEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNL- 133

  Fly   473 WEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKM 537
             |:.||.::.|||.:.:.|||...:.::.:...||...  ||...||..|..|..:..::...|.
  Fly   134 -EFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVP--YVKGATERFVSSPEDVFEVIEEGKS 195

  Fly   538 NRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSES-PKT---STRMTETKN 598
            ||..|.|..||.|||||:|..:.:...:.|.|:...|.:.||||||||. .||   .|.:.|.||
  Fly   196 NRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSKTGAEGTVLDEAKN 260

  Fly   599 INRSLSELTNVILALLQ-KQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQES----- 657
            ||:|||.|.|||.||.. .:.|||||:||||.:|..|||||::|.:.|..||..  |.||     
  Fly   261 INKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPAS--FNESETKST 323

  Fly   658 ------VKSLRFAASVNSCKMTKAKRNRYLNNSVANS 688
                  .|:::....||.....:..:.||......|:
  Fly   324 LDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 134/344 (39%)
KISc 348..678 CDD:214526 134/350 (38%)
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820 132/333 (40%)
KISc 12..340 CDD:214526 132/340 (39%)
Apolipoprotein 595..744 CDD:279749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.