DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and cos

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001260765.1 Gene:cos / 35653 FlyBaseID:FBgn0000352 Length:1201 Species:Drosophila melanogaster


Alignment Length:336 Identity:83/336 - (24%)
Similarity:138/336 - (41%) Gaps:94/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 VFHPL---SSQSDIF-EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDG-------VPESVGVI 454
            |.|.|   |||..:: :.|.|||...|:|::..:..|||.|.||:||:.|       ...:.||:
  Fly   138 VTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDPTLTDSTEGVV 202

  Fly   455 PRTVDLLFDSIRGYRNLGWE--YEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNI 517
            ...|..:|..|    :|..|  |.|...|:||....:.|||              ...:|:.:|:
  Fly   203 QLCVRDIFSHI----SLHPERTYAINVGFVEICGGDVCDLL--------------GMGNIHCTNV 249

  Fly   518 TEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEIS--------VG 574
            ..           :.|..::..:.      .:|..:|.:..|.|     |:|.:|        :.
  Fly   250 DA-----------VFHWLQVGLSA------RQSLPAHTLFTLTL-----EQQWVSKEGLLQHRLS 292

  Fly   575 SINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVILALLQK------QDHIPYRNSKLTH 629
            :.:..||.|:|    .|       ..:.::..|..|..||..|...      ..:|||..:.||.
  Fly   293 TASFSDLCGTERCGDQP-------PGRPLDAGLCMLEQVISTLTDPGLMYGVNGNIPYGQTTLTT 350

  Fly   630 LLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSST---- 690
            ||..|.||.::||:.:.|||.::...|::.:|:||..|      :..||..:.|:.::.:|    
  Fly   351 LLKDSFGGRAQTLVILCVSPLEEHLPETLGNLQFAFKV------QCVRNFVIMNTYSDDNTMIVQ 409

  Fly   691 ------QSNNS 695
                  :||:|
  Fly   410 PAEPVPESNSS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 76/301 (25%)
KISc 348..678 CDD:214526 76/307 (25%)
cosNP_001260765.1 Motor_domain 132..389 CDD:277568 76/303 (25%)
SPEC 657..856 CDD:295325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.