DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Kif15

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_038937602.1 Gene:Kif15 / 353302 RGDID:727790 Length:1396 Species:Rattus norvegicus


Alignment Length:402 Identity:144/402 - (35%)
Similarity:200/402 - (49%) Gaps:58/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 CKEQLFQSNMERKELHNTVMDLRGN----IRVFCRIRPPLESE-----ENRMCCTWTYHDESTVE 379
            ||.:|       :.:.|:..:...|    |:||.||||..|..     |..:|.:         .
  Rat     5 CKSEL-------RNVTNSHSNQPSNEDDAIKVFVRIRPAEEGARSADGEQSLCLS---------V 53

  Fly   380 LQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYT 443
            |.....:..|....:.|.||.|....::|..:|..|: .:::|.:.|||..||||||||||||:|
  Rat    54 LSQTALRLHSNPDPKTFVFDYVAGMDTTQESVFSTVAKSIVESCMSGYNGTIFAYGQTGSGKTFT 118

  Fly   444 MDGVPES-------VGVIPRTVDLLF---DSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQK 498
            |.|..:|       .|||||:.:.||   |..:.....|..:..|.:|:|:|||.:||||.:...
  Rat   119 MMGPSDSDNFSHNLRGVIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEVYNEQIYDLLDSASV 183

  Fly   499 DMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAV--TKLEL 561
            .:.:|  ::.|..::|....|:.|........::.....||..|||:.|..|||||||  ..:|.
  Rat   184 GLYLR--EHIKKGVFVVGAVEQVVASAAEAYQVLSRGWRNRRVASTSMNRESSRSHAVFTITIES 246

  Fly   562 IGRHAEKQEISVGSINLVDLAGSESPKTS----TRMTETKNINRSLSELTNVILALLQ----KQD 618
            :.:.:|...|....:|||||||||..|.:    .|:.|..|||||||.|..||.||:.    ||.
  Rat   247 MEKSSEAVNIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVITALVDVGNGKQR 311

  Fly   619 HIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNN 683
            |:.||:||||.||..|||||:||.:..||.|...||.|::.:|.||   ...|:.|       |.
  Rat   312 HVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFA---QRAKLIK-------NK 366

  Fly   684 SVANSSTQSNNS 695
            :|.|..||.|.|
  Rat   367 AVVNEDTQGNVS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 131/355 (37%)
KISc 348..678 CDD:214526 133/359 (37%)
Kif15XP_038937602.1 KISc_KLP2_like 25..373 CDD:276824 135/368 (37%)
Smc <361..1126 CDD:224117 9/25 (36%)
SbcC 876..>1396 CDD:223496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.