DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp31E

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001162935.1 Gene:Klp31E / 34422 FlyBaseID:FBgn0032243 Length:1048 Species:Drosophila melanogaster


Alignment Length:391 Identity:131/391 - (33%)
Similarity:184/391 - (47%) Gaps:69/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENRMC--CTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSD 410
            ::||..||||....|...||  ||.....|..:.|.|          .:.|:||.||...|:|.|
  Fly    13 SVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGS----------DKAFTFDYVFDTNSNQCD 67

  Fly   411 IF-EMVSPLIQSALDGYNICIFAYGQTGSGKTYTM----DGVPES-----VGVIPRTVDLLFDSI 465
            |: :.|..|:.|.|.|||..:.|||||||||||||    |...||     :|:|||.|..:|..|
  Fly    68 IYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGI 132

  Fly   466 RGYRNLGW----------EYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEE 520
            ........          ::.:...::|:|||.::|||....|:...::.::....|.:|..:.:
  Fly   133 EQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFNKNSNFKIHEDASGQITISGASIK 197

  Fly   521 TVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINL------- 578
            .:..|:.....:....:.|.||||..|::||||||:..:     ...:|.:...|.|:       
  Fly   198 PIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTI-----FVRRQRLLTPSDNVPDNDLET 257

  Fly   579 -------VDLAGSESPK----TSTRMTETKNINRSLSELTNVILALLQKQD---HIPYRNSKLTH 629
                   |||||||..|    |..|..|..:||..|..|.|.|.||..|..   |:|||:||||.
  Fly   258 LTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTR 322

  Fly   630 LLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSSTQSNN 694
            ||..||||||:|||...|||....|.|::.:|::           |.|.|.:.|.|..:..||:.
  Fly   323 LLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKY-----------ANRARNIKNKVKINQDQSSR 376

  Fly   695 S 695
            :
  Fly   377 T 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 124/366 (34%)
KISc 348..678 CDD:214526 125/372 (34%)
Klp31ENP_001162935.1 KISc_KIF4 12..364 CDD:276823 127/376 (34%)
KISc 13..370 CDD:214526 129/382 (34%)
KASH_CCD 409..589 CDD:291334
RasGAP <685..750 CDD:295371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.