DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and nod

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster


Alignment Length:335 Identity:96/335 - (28%)
Similarity:155/335 - (46%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 QQIFSFDQVFHPLSSQSDIFE-MVSPLIQSALDGYNICIFAYGQTGSGKTYTM------DGVPES 450
            |..|.||..|....||.:::: ::.||:...|:|:.....||||||:||:|:|      :.:||.
  Fly    45 QNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEH 109

  Fly   451 VGVIPRTVDLLFDSIRG-YRNLGWEYEIKATFLEIYNEVLYDLL-SNEQKDMEIRMAKNNKNDIY 513
            :|::||.:..:|:.:.. ..|.....::.|:|:|||||..:||| |.....|             
  Fly   110 LGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPM------------- 161

  Fly   514 VSNITEETVLDPNH----LRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVG 574
            |:...:.....|.|    |.|::.....||....|..|..||||||:..:.:      |.:....
  Fly   162 VAARCQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHV------KSKTHHS 220

  Fly   575 SINLVDLAGSESPKTS----TRMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSL 635
            .:|:|||||||..:.:    ....|..|||..|..:..|::::......||||:|.||.:|..||
  Fly   221 RMNIVDLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASL 285

  Fly   636 GGNSKTLMFINVSPFQDCFQESVKSLRFAAS-----VNSCKMTKAKRN----------RYLNNSV 685
            ...|.......:||.|....|::.:|||..|     :|..::.:.|::          :.|..|.
  Fly   286 TAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNPMQVARQKQSLAARTTHVFRQALCTST 350

  Fly   686 ANSSTQSNNS 695
            |..|..:|::
  Fly   351 AIKSNAANHN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 90/300 (30%)
KISc 348..678 CDD:214526 91/306 (30%)
nodNP_001285129.1 KISc 8..325 CDD:214526 90/298 (30%)
KISc 8..318 CDD:276812 89/291 (31%)
ComEA 540..648 CDD:224472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.