DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp3A

DIOPT Version :10

Sequence 1:NP_476651.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_525053.1 Gene:Klp3A / 31240 FlyBaseID:FBgn0011606 Length:1212 Species:Drosophila melanogaster


Alignment Length:236 Identity:46/236 - (19%)
Similarity:91/236 - (38%) Gaps:74/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 NIPNEGSIITQTIYKNESLIEDFNAKFVFALPFILGTSISKE----KLAGLRKRFLKNTPTSQWV 416
            :|.:.||.:|:|   .|..:|:.|.:          |.:.::    ||..:...||.:|.:|  :
  Fly   446 SIESSGSDVTET---TEDDLEELNRR----------THLPRDHPARKLLPIDLMFLVDTSSS--I 495

  Fly   417 TRNNYAEITKLFSEAYFQYPMVKNI-----KQHLANRKNTSTSVYSFQFRGRYSFSKLLTGSEK- 475
            ..||: :|.|     .|...::|::     :..:|..:.:......|.|...||:..:..|..: 
  Fly   496 GINNF-DIQK-----NFICEILKDVDIAPGRSRIAMIQYSQDPSVVFGFDQYYSYESVRRGVMRL 554

  Fly   476 SY--GISLLDEMI---------------------YLFRMPLFFPEFPPGSPEAEMTQLWVKFIV- 516
            ||  |.::|.:.:                     ||              |..:..:|.|..:| 
  Fly   555 SYTGGATMLSKALAFAGGIMYHEQNLKKTTKKHQYL--------------PTPKHDRLQVLCLVS 605

  Fly   517 -----DFATQESVDKIGTCYGEKCDVVTFANSNNRYFPVSK 552
                 |.|.:|||:.....:.:...|||.:.:.::..|:::
  Fly   606 DGYSDDNADKESVNLHDHLHVKIFAVVTRSFNKDKLAPITR 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_476651.1 PRK03918 <204..350 CDD:235175
KISc_C_terminal 346..672 CDD:276817 46/236 (19%)
Klp3ANP_525053.1 KISc_KIF4 7..336 CDD:276823
Smc <453..>985 CDD:440809 43/229 (19%)
Metallothio <1071..1115 CDD:395080
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.