DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Klp3A

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001284830.1 Gene:Klp3A / 31240 FlyBaseID:FBgn0011606 Length:1212 Species:Drosophila melanogaster


Alignment Length:332 Identity:132/332 - (39%)
Similarity:182/332 - (54%) Gaps:27/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 IRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFE 413
            :.|..|:||.::||.:|.|       ...||..:..|...:....:.::::.||....||.|:||
  Fly     9 VAVALRVRPLVQSELDRGC-------RIAVERSADGAPQVTVNRNESYTYNYVFDIDDSQKDLFE 66

  Fly   414 -MVSPLIQSALDGYNICIFAYGQTGSGKTYTM----DGV-PESVGVIPRTVDLLFDSIRGYRNLG 472
             .|...::..|:|||:.|.|||||||||||||    :|| .:.||||||.|..:|.:|...:: .
  Fly    67 TCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGVLDDHVGVIPRAVHDIFTAIAEMQS-E 130

  Fly   473 WEYEIKATFLEIYNEVLYDLLSNEQKD---MEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHT 534
            :.:.:..:|:|:|.|..|||.|::.:|   ::||..||.   |.:..:||..|.....:...:..
  Fly   131 FRFAVTCSFVELYQEQFYDLFSSKTRDKATVDIREVKNR---IIMPGLTELVVTSAQQVTDHLIR 192

  Fly   535 AKMNRATASTAGNERSSRSHAVTKLELIGRHAE-KQEISVGSINLVDLAGSE-SPKT---STRMT 594
            ....||.|:||.||.||||||:..|.|:....: ||.::....||||||||| ..||   ..|..
  Fly   193 GSAGRAVAATAMNETSSRSHAIFTLTLVATKLDGKQSVTTSRFNLVDLAGSERCSKTLASGDRFK 257

  Fly   595 ETKNINRSLSELTNVILAL--LQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQES 657
            |..|||:.|..|.|||.||  .|...:||||.||||.||..||||||.|||...|||......|:
  Fly   258 EGVNINKGLLALGNVINALGSGQAAGYIPYRQSKLTRLLQDSLGGNSITLMIACVSPADYNVAET 322

  Fly   658 VKSLRFA 664
            :.:||:|
  Fly   323 LSTLRYA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 132/332 (40%)
KISc 348..678 CDD:214526 132/332 (40%)
Klp3ANP_001284830.1 KISc_KIF4 7..336 CDD:276823 132/332 (40%)
Kinesin 14..335 CDD:278646 131/327 (40%)
Smc <396..>994 CDD:224117
FlaC 522..633 CDD:225888
TCR 1075..1110 CDD:281618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.