DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and Kif15

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_034750.1 Gene:Kif15 / 209737 MGIID:1098258 Length:1387 Species:Mus musculus


Alignment Length:399 Identity:146/399 - (36%)
Similarity:202/399 - (50%) Gaps:52/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 CKEQLFQSNMERKELHNTVMDLRGN-IRVFCRIRPPLESE-----ENRMCCTWTYHDESTVELQS 382
            ||.:|  .|:...  |:......|: |:||.||||..|..     |...|.  :...::|:.|. 
Mouse     5 CKSEL--RNVTNS--HSNQPSNEGDAIKVFVRIRPAEEGARSADGEQSFCL--SVLSQTTLRLH- 62

  Fly   383 IDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYTMDG 446
                  |....:.|.||.|....::|..:|..|: .:::|.:.|||..||||||||||||:||.|
Mouse    63 ------SNPDPKTFVFDYVAGMDTTQESVFSTVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMG 121

  Fly   447 VPES-------VGVIPRTVDLLF---DSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDME 501
            ..:|       .|:|||:.:.||   |..:.....|..:..|.:|:|:|||.:||||.:....:.
Mouse   122 PSDSDNFSHNLRGIIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEVYNEQIYDLLDSASVGLY 186

  Fly   502 IRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAV--TKLELIGR 564
            :|  ::.|..::|....|:.|........::.....||..|||:.|..|||||||  ..:|.:.:
Mouse   187 LR--EHIKKGVFVVGAVEQAVTSAAETYQVLSRGWRNRRVASTSMNRESSRSHAVFTITIESMEK 249

  Fly   565 HAEKQEISVGSINLVDLAGSESPKTS----TRMTETKNINRSLSELTNVILALLQ----KQDHIP 621
            .:|...|....:|||||||||..|.:    .|:.|..|||||||.|..||.||:.    ||.||.
Mouse   250 SSETVNIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVITALVDVGNGKQRHIC 314

  Fly   622 YRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVA 686
            ||:||||.||..|||||:||.:..||.|...||.|::.:|.||   ...|:.|       |.:|.
Mouse   315 YRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFA---QRAKLIK-------NKAVV 369

  Fly   687 NSSTQSNNS 695
            |..||.|.|
Mouse   370 NEDTQGNVS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 132/352 (38%)
KISc 348..678 CDD:214526 133/356 (37%)
Kif15NP_034750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 5/21 (24%)
KISc_KLP2_like 25..373 CDD:276824 136/368 (37%)
KISc 26..370 CDD:214526 135/364 (37%)
Kinesin-relat_1 463..551 CDD:289481
SMC_prok_B 520..1339 CDD:274008
HMMR_C 1267..>1387 CDD:292530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.