DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and psf-1

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_496153.2 Gene:psf-1 / 187885 WormBaseID:WBGene00011275 Length:201 Species:Caenorhabditis elegans


Alignment Length:216 Identity:43/216 - (19%)
Similarity:74/216 - (34%) Gaps:66/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 VVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKEL------HNTVMDLRGNIRVFCRIRPP 358
            |:.:::..:.|...|.:...:.....::|||.|....|.      |::.: |:..:...|.||. 
 Worm    19 VLEMKRNPDVLPPYNTELVRQCYQKIDELFQKNAAVVEKIRAGLPHDSTL-LQPRLAAMCHIRR- 81

  Fly   359 LESEENRMCCTWTYHDESTVELQS--------IDAQAKSKMGQQIFSFDQVFHPLSS-----QSD 410
                     |...|.:|....::|        :.|..::.:......|   |:..||     ||:
 Worm    82 ---------CMMAYVNERKNRIRSFRWKYGGALPASVRNALCDAEIQF---FNEYSSTLARFQSN 134

  Fly   411 IFE-MVSPLIQS-----------ALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFD 463
            :.| .|:.|:.|           ||:.|            |:..|.||.         .|.|..|
 Worm   135 LGEGGVNLLLHSAPPKSLFVQVRALEDY------------GEFETSDGT---------QVQLSKD 178

  Fly   464 SIRGYRNLGWEYEIKATFLEI 484
            |:........|..|:...||:
 Worm   179 SLHSLPRQDCEMLIRQGVLEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 33/164 (20%)
KISc 348..678 CDD:214526 33/162 (20%)
psf-1NP_496153.2 GINS_A_psf1 12..137 CDD:212548 24/131 (18%)
COG5230 18..200 CDD:227555 43/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.