DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and zen-4

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001360082.1 Gene:zen-4 / 177374 WormBaseID:WBGene00006974 Length:787 Species:Caenorhabditis elegans


Alignment Length:429 Identity:122/429 - (28%)
Similarity:184/429 - (42%) Gaps:92/429 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 QSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQ 394
            :..:.||:|.....|   :|.|.||:.|...|..:.:..     ||.:::.....||.:.:...|
 Worm    12 RDQVRRKKLSIEETD---SIEVVCRLCPYTGSTPSLIAI-----DEGSIQTVLPPAQFRRENAPQ 68

  Fly   395 ---IFSFDQVFHPLSSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYTMDGVP--ESVGV 453
               :|.|.:||.....|:.:||..| .||.:.|.|.|..:|.||.|||||||||.|.|  ...|:
 Worm    69 VEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGL 133

  Fly   454 IPRTVDLLFDSIRG-------YRNLGWEYEIKA-------------------------------- 479
            :|||:|::|:||..       |.:....:||:|                                
 Worm   134 LPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKL 198

  Fly   480 -------------TFLEIYNEVLYDLLSNEQKDMEIRMAKNNKND----IYVSNITEETVLDPNH 527
                         |::||||...||||.:.:....:...:..::|    :||....:..|.....
 Worm   199 SGYNDDMVCSVFVTYVEIYNNYCYDLLEDARNGSRVLTKREIRHDRQQQMYVDGAKDVEVSSSEE 263

  Fly   528 LRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGR-----------HAEKQEISVGSINLVDL 581
            ...:....:..|..:||..|:.|||||:|..::|:..           ..:..:|.|..:.||||
 Worm   264 ALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDL 328

  Fly   582 AGSESPK----TSTRMTETKNINRSLSELTNVILALLQKQ-------DHIPYRNSKLTHLLMPSL 635
            ||||..|    ...|:.|..:||:||..|...|..|.:.|       :.:|||.||||||....|
 Worm   329 AGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYL 393

  Fly   636 GGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTK 674
            .||.|..|.|.|:|..|.:.|::.:|.||....:.::.|
 Worm   394 EGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 117/409 (29%)
KISc 348..678 CDD:214526 118/411 (29%)
zen-4NP_001360082.1 Motor_domain 26..426 CDD:354959 118/407 (29%)
MKLP1_Arf_bdg 674..>748 CDD:374613
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.