DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and AgaP_AGAP007706

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_308170.4 Gene:AgaP_AGAP007706 / 1269528 VectorBaseID:AGAP007706 Length:871 Species:Anopheles gambiae


Alignment Length:434 Identity:113/434 - (26%)
Similarity:187/434 - (43%) Gaps:98/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 KELHNTVMDLRGN---------IRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKM 391
            |.|..:.:..|||         ::|:||:||| ..|.:..|...|  |..||.|...:.....|:
Mosquito    11 KVLPKSAIKSRGNSGNNLGKDPVQVYCRVRPP-PCESDLTCLRVT--DPHTVVLTPPEIAINYKI 72

  Fly   392 G---QQIFSFDQVFHPLSSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVG 452
            .   :..:.|.:||.....|.:::..|: ||::..:.|.|..:|.||.|||||||||.|..:..|
Mosquito    73 ANLKETQYIFKRVFDDAVRQHEVYVSVAQPLVEGLIRGRNGLLFTYGVTGSGKTYTMTGDLQHRG 137

  Fly   453 VIPRTVDLLFDSIRGY-----------------------------------------RNLGWE-- 474
            ::||.:|.||.:|..|                                         ::|..|  
Mosquito   138 IMPRCLDALFRTIADYQAKKYTFKSDRLNGFDILTEAEVLLERQAELNAKLTKSTRKKDLDQEVA 202

  Fly   475 ------------------YEIKATFLEIYNEVLYDLL--SNEQKDMEIRMAKNN-KNDIYVSNIT 518
                              |.:...::|:||..:||||  :..||.::.:|.:.: :::::|..:|
Mosquito   203 SQVSVEPSEISGIEEDNIYAVFINYVEVYNNSVYDLLEETTVQKTLQSKMVREDAQHNMFVHGVT 267

  Fly   519 EETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELI-------GRHA--EKQEISVG 574
            |..|........|....:..:....|..|..|||||:|..:.|:       |.:.  ::..|:|.
Mosquito   268 EVEVKSVEEALELFQIGQKRKRMGHTILNAESSRSHSVFTIRLVQAPVDVQGENVVQDRNAITVS 332

  Fly   575 SINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVILALLQKQD-----HIPYRNSKLTHL 630
            .::||||||||    :..|..|:.|..|||.||..|...:..|.:.|.     .:|||:||:|||
Mosquito   333 QLSLVDLAGSERTNRTGNTGQRLREAGNINNSLMTLRTCLEILRENQQTCGGKKVPYRDSKITHL 397

  Fly   631 LMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTK 674
            ......|..:..|.:.|:|..:.:.|:.:.::||......::.:
Mosquito   398 FKNYFDGEGQVRMIVCVNPRAEDYDETAQVMKFAEMTQDVQIAR 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 111/420 (26%)
KISc 348..678 CDD:214526 109/422 (26%)
AgaP_AGAP007706XP_308170.4 KISc_KIF23_like 31..435 CDD:276819 108/406 (27%)
Kinesin 38..437 CDD:278646 106/401 (26%)
Uds1 508..612 CDD:292096
Tropomyosin_1 546..675 CDD:289488
TMPIT 588..>661 CDD:285135
MKLP1_Arf_bdg 720..821 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.